Lachnospiraceae bacterium M18-1
Average proteome isoelectric point is 6.21
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 5,263 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|R9K8B2|R9K8B2_9FIRM Uncharacterized protein (Fragment)
SMSDTSMSDASMSDMSMSDASMSDTSMSDASMSDVSMSDASMSDVSMSDTSMSDASMSDASMSDASMSDMSMSDASISDASMSDASMSDVSMSDASMSDVSMSDASMSDMSMSDASISDASMSDTSMSDASMSDTSMSDASMSDASMSDASMSDASMGDASMSDVSMSDMSMSDASMSDMSMSDASMSDV
SMSDASMSDASMSDASMSDVSMSDTSMSDVSMSDASMSDMSMSDASISDASMSDASMSDISMSDASMSDASMSDVSMSDTSMSDASMSDVSMSDASMSDASMSDASISDASMSDASMSDASMSDASMSDTSMSDASMSDASMSDMSMSDASISDASMSDASMSDTSMSDMSMSDASMSDASMSDASMSDT
SMSDASMSDASMSDASMSDTSMSDTS
Molecular weight: 40.96 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|R9K488|R9K488_9FIRM Uncharacterized protein
MTLKQKRIIILIIIIIAAAVLGRLAVRAFLNFLLGGTLFGGNFL
Molecular weight: 4.78 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
5,230 |
33 |
5,263 |
1,630,802 |
23 |
2,742 |
311.8 |
35.2 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.46 |
1.56 |
5.52 |
8.09 |
4.13 |
7.14 |
1.81 |
7.02 |
6.53 |
9.01 |
3.15 |
4.04 |
3.51 |
3.39 |
5.07 |
5.77 |
5.09 |
6.46 |
1.02 |
4.25 |
Note: For statistics only major isoforms were used (in this case 5,230 proteins)
For dipeptide frequency statistics click
here