Canine oral papillomavirus (strain Y62) (COPV)
Average proteome isoelectric point is 6.18
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 7 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>sp|Q89759|VE7_COPV6 Protein E7
MIGQCATLLDIVLTEQPEPIDLQCYEQLPSSDEEEEEEEPTEKNVYRIEAACGFCGKGVRFFCLSQKEDLRVLQVTLLSLSLVCTTCVQTAKLDHGG
Molecular weight: 10.8 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|Q89420|VE2_COPV6 Regulatory protein E2
MEKLSEALDLLQEELLSLYEQNSQSLADQSRHWSLLRKEQVLLYYARGKGIMRIGMQPVPPQSVSQAKAKQAIEQSLYIDSLLHSKYANEPWTLCDTSRERLVAEPAYTFKKGGKQIDVRYGDSEENIVRYVLWLDIYYQDEFDTWEKAHGKLDHKGLSYMHGTQQVYYVDFEEEANKYSETGKYEILNQ
PTTIPTTSAAGTSGPELPGHSASGSGACSLTPRKGPSRRPGRRSSRFPRRSGGRGRLGRGGSGELPPQPQPSSSWSPPSPQQVGSKHQLRTTSSAGGRLGRLLQEAYDPPVLVLAGDPNSLKCIRYRLSHKHRGLYLGASTTWKWTSGGDGASKHDRGSARMLLAFLSDQQREDFMDRVTFPKSVRVFRG
GLDEL
Molecular weight: 43.1 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
7 |
0 |
7 |
2,357 |
97 |
597 |
336.7 |
37.8 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
5.26 |
2.25 |
6.07 |
6.58 |
4.5 |
7.0 |
2.33 |
4.33 |
5.39 |
9.5 |
1.4 |
3.52 |
4.45 |
7.0 |
6.19 |
8.4 |
5.69 |
5.69 |
1.36 |
3.1 |
Note: For statistics only major isoforms were used (in this case 7 proteins)
For dipeptide frequency statistics click
here