Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Average proteome isoelectric point is 6.44
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 3,272 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|B8GPW0|B8GPW0_THISH Uncharacterized protein
MTSGRTLSGNYPGHPKATGMSWLTPATLLVASLALAGCGGGGGSSNPADPVISTTAIDGAVSKGPVVGAQVLLYLAGADGGHTGEPVAGPFTTIADGTWDDEIPEELPRPLVVIATGGSYTDEATGDTVELGSRSLRSYLPADADTVAVTPLTELLVRVTQEQIADSPDTTIENALDAAKNTLNQALAIN
FDPLTTKPLDINNAGDGDRDQRAYTAILAGLSVLANNLAPTADPFEVVQALIDDMSDGTLDGQKAGEPVPVGDSEDTLPTTTTTDLLIAINTAIDEADDSSAFDDVAVSEDGEGNLVISPRYTLGGTVSGLLGSGLVLQEGALELPIESSGSFTFSGFFDAETSYSVTVLTQPTSPMQTCSVTNGSGEVS
EDVTNIVVSCETDTFTVGGTVSGLDAEESLILQNNGTDSLPVTSNGGFVFDTPVQDQAPYNVTILTLPESGQICGVINGIGNINAAAVDDVVVSCDLITVSMDVINGSFSSQGSQVVDGTLVLLIQPEPGYALVEGSVEVVGEGCSGELDGNLYTVTLGSEACTVTAEFEEAPLDGATWGNFNWGEANWQ
Molecular weight: 58.29 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|B8GRD4|RL34_THISH 50S ribosomal protein L34
MKRTFQPSTLKRKRTHGFRARMATRGGRKVLAARRAKGRVRLCP
Molecular weight: 5.11 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,249 |
23 |
3,272 |
996,589 |
31 |
3,954 |
306.7 |
33.8 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
10.98 |
0.88 |
5.7 |
6.62 |
3.38 |
8.28 |
2.52 |
4.64 |
2.67 |
11.27 |
2.54 |
2.53 |
3.7 |
5.11 |
8.03 |
5.01 |
4.81 |
7.55 |
1.38 |
2.4 |
Note: For statistics only major isoforms were used (in this case 3,249 proteins)
For dipeptide frequency statistics click
here