Candida maltosa (strain Xu316) (Yeast)
Average proteome isoelectric point is 6.17
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 5,976 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|M3JB23|M3JB23_CANMX Interspersed repeat antigen (FIRA) protein (Fragment)
PTEEPTEEPTEEPTEEPTEEPTEEPTEEPTEEPTEELTEELTTDEPSSLAGESTVSEESSTEEEATTDEPTTSEEPFTTEEPSTDNESSTEEEPTTTDGEPFTTDEPSTTGEPTTDEESTTEEESTTDEPSTTDEESSIDEPSSLAGESTVSEDSSTTDEFSTEESSTEEEPSTTDGEATSDEESTTDDE
STTEEPSIDEPSTTDEPSTTDEVSTDDEESTTDEPSTTGEESIDEPSSLAGESTVSEDSSTTDEPPITDAESSTEESSIDEPTTSDEPSTTDEETEPTTTNESSTDEPSIDEPSSLAGESTVSEESSITDGASTTDEESITVEESTTGEESEPSNTDEESEPSSLAAESTVSEEASNTDEVSTIDEPLTD
SSSGTNSDTDSIGTPDTVTTTVTADASSGIDTPDDSGASDTFGQDSDNTEQPSSGSVTTPQVFTTTWTITDAEGSVTSETGVVSQSGSVITTLTTFTQYVTLTTEEEVINAETTGTGEEDSGTGEQDSGAGEQGSGAGEQDSGAGEQDSGVGEQDSGAGEEDSGAGEQDSGVGEQDSGVGEQDSGVGEQD
SGFGGNGDTAGGQAPNVSDEDSTLVTLSASSFGPTPTESFATSLAGPATIVDNSSNAIAINILAAIGSLLAVFI
Molecular weight: 66.14 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|M3JUP7|M3JUP7_CANMX Uncharacterized protein (Fragment)
STRATSCTTTTNSSSTVASSGSANTSTRVTRSRTTTRSTTARKSTTVSTILPPVSSGPLKNITNTVSARSRRVKTASKK
Molecular weight: 8.19 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
5,976 |
0 |
5,976 |
2,856,021 |
10 |
4,888 |
477.9 |
54.0 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
5.18 |
1.06 |
6.15 |
6.72 |
4.5 |
5.12 |
2.09 |
6.89 |
7.27 |
9.18 |
1.82 |
6.18 |
4.26 |
4.7 |
3.79 |
8.7 |
6.08 |
5.77 |
0.99 |
3.55 |
Note: For statistics only major isoforms were used (in this case 5,976 proteins)
For dipeptide frequency statistics click
here