Pseudomonas sp. BAY1663
Average proteome isoelectric point is 6.67
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 5,053 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|W9T550|W9T550_9PSED Uncharacterized protein
MKKSITLSSCTALALILSVSMAAGCSATTKKYYVSDSSSSTPVDPGNGNGGGGNGDGDGSGGGGNGDGSGNGDGGGNDGSDPLAGGTISDVQDLVGSTVEGSPLAPVSDLVDNLVDPESGLLAPVTGLVDNLTGSGGALQPVGDLLGGVIGSDGVLQPVVGIVNGVLAEGSVGSGSVSQLQTTVGQLTGS
EGGLAPVSDLVDTLANPSSGLLSPVTGLVDRVTGQGGALQPVGDLTGGLLGESGALSPVLGTVNGVVGGLGLAPVTDAVGGVVGGVNGLVDGVTTTLASGQTGSGVITDAQGTVSTLVNGTALAPVGALADNLVDPASGVLAPMTGLVEGLTGQGGALEPVGGLVGGLVGEEGALSPVVGTVNGLLVGLT
GAEGGLLGGLTGGEGGLLGGLVGGESGLLGGLAGGENGLLGGLTGGEGGLLGGLAGGAGDGSGSIGAVQGTLGTLTEGTALVPVGGLVNGLVDPSSGALAPVTGLVDNLTAPSGALAPVGGLVGGLVGEEGALSPVVGTVNGLLVGLTGAEGGLLGGLTGGEGGLLGGLTGGEGGLLGGLTGGEGGLLGG
AEGVLGGLTGGTTGALLGGLGGGSGEGSGAISDVQGALGTLTNGTALAPVGGLVNGLVDPSSGALAPVTGLVDNLTAPSGTLAPVGGLVGGLVGEQGALTPVLGTVNGLVGGLAGGLTGDTQAGNGGLLGGLLGGLGGASQN
Molecular weight: 64.1 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|W9T7W3|W9T7W3_9PSED 50S ribosomal protein L34
MKRTFQPSTIKRARTHGFRARMATKNGRQVLSRRRAKGRKRLTV
Molecular weight: 5.21 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
5,034 |
19 |
5,053 |
1,385,844 |
29 |
2,815 |
275.3 |
30.2 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
11.5 |
1.09 |
5.29 |
6.09 |
3.49 |
8.1 |
2.3 |
4.6 |
3.05 |
11.94 |
2.3 |
2.69 |
4.47 |
5.01 |
7.33 |
5.52 |
4.52 |
6.81 |
1.46 |
2.43 |
Note: For statistics only major isoforms were used (in this case 5,034 proteins)
For dipeptide frequency statistics click
here