alpha proteobacterium AAP81b
Average proteome isoelectric point is 6.98
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 3,055 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0N1AZU3|A0A0N1AZU3_9PROT Uncharacterized protein
MNLLLFFGRTYADLVVVTADVGAENLQLIFGGSAFVVDAQNVITSGTVTGFGFADSDDTPLLAILDISVAATSVYGAFASASVFDDVTLVGGLLTGNDIFLLSEFADNVSSGSGDDNIQTFGGNDTVFGESGGDTVLGGTGDDMIFGQSGIDWLFGEGDDDTLDGGSGDDVLVGGTGSDTYNVDSSGDVI
FEEGGDLDGANSSAFLFFLWDGVEDLVLVERSDAVYGVGNSAGNRIFGNAAVNALFGVDGNDSLNGAAGSDFLFGGAGNDTLIGGASFDTDQLVGDEGNDLLNAASGLGDFDLLYGGTGNDVYWVDTFADATDEGLFEGIDTVIAFIPDGGYFLYANVENLTLGGTTSFGVGNDLANILTGNNSLNIFYG
GEGNDTIDGGGGTDYLVGQGGADVFKLRPGTEFDWIVDFQQGIDRIDLSAFGFTNTSQLAARLTDFGGTAVVDLGDGDLLAIFGIAAASLTVGDFII
Molecular weight: 48.71 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0N0K3B5|A0A0N0K3B5_9PROT Uncharacterized protein (Fragment)
MPHRRTIARRTGAALALAAALALTIGALGAAVPLFDIVNLLRPVLAAIGVAGAGLLLWARARRAAAAAAV
Molecular weight: 6.98 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,040 |
15 |
3,055 |
931,599 |
41 |
5,206 |
306.4 |
32.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
15.74 |
0.7 |
5.94 |
4.62 |
3.5 |
9.5 |
1.81 |
4.65 |
2.39 |
10.31 |
2.05 |
2.36 |
2.62 |
5.59 |
7.5 |
4.51 |
5.4 |
7.45 |
1.43 |
1.95 |
Note: For statistics only major isoforms were used (in this case 3,040 proteins)
For dipeptide frequency statistics click
here