Streptococcus equi subsp. equi
Average proteome isoelectric point is 6.42
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 4,667 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0G7I2G7|A0A0G7I2G7_9STRE Ribosomal protein S12
MLNDSLSLNDPLSLKDSLVLNDPLSLKDSLVLNDSLSLNDSDSLNDSLVLSDSLSLNDSLVLNDSLALNDSDSLNDSLSLNDSDSLNDSLALNDSLVLNDSLALNDSLALNDSLALNDSLALNDSLVLNDSLSLNDSLVLNDSLALNDSLALNDSYSLNDSLALNDSLSLIDSLALNDSDSLNDSLALND
SLSLNDSLALNDSLALNDSLALNDSLALIDSDSLNDSLALNDSLSLNDSLELNDSLALNDSLSLNDSLSLNDSLSLNDSLSLNDSLVLKDSLSLNDSLVLNDSLSLNDSLSLNDSLSLNDSLSLNDSLALNDSDWLNDSLVLKDSD
Molecular weight: 35.41 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0G6IN76|A0A0G6IN76_9STRE 50S ribosomal protein L34
MKRTYQPSKIRRQRKHGFRHRMSTKNGRRVLASRRRKGRKVLSA
Molecular weight: 5.38 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
4,598 |
69 |
4,667 |
1,324,214 |
29 |
3,975 |
288.0 |
32.4 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.19 |
0.61 |
5.78 |
6.69 |
4.44 |
6.37 |
2.17 |
8.1 |
7.08 |
9.71 |
2.63 |
4.92 |
4.19 |
3.24 |
3.77 |
6.17 |
5.63 |
6.63 |
0.83 |
3.85 |
Note: For statistics only major isoforms were used (in this case 4,598 proteins)
For dipeptide frequency statistics click
here