Bacillus clausii (strain KSM-K16)
Average proteome isoelectric point is 6.3
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 4,082 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|Q5WJD3|Q5WJD3_BACSK Uncharacterized protein
MSSKKYDYKKKMKNRQKRKMNTLSKVVASTAITTLTIVPFSNLINAEGVSGNVLTNPSAYASAASLTEFQLLTDVAVNAQLGDADENGLYDLGLSLTGRGLADAELFGPERTVIFYSPDLADKWTVEGPAQVRVEILPVTMDALPTLGNLIGDITQQLNSVVNDLVNTVDGIVNNPITAPLIRVSGLTEL
QDALSALNNIDGALADLLAYNDEVEAVVQPDGSILVNFSDGLGNHLESAVQDVVVQLLNDVVDAIGNVSIDILGGGISVPLEPLQALVQPLLGLIDNISSGAVDLSNDLAGVQLLGSTEVTLNAKVDGTDVSGEVPIYGAGVHDSTIDLQLLNSIGDYDTVIFDDDSDADADADADADADADADADADAD
ADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADAD
ADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADTDADADADADADTDKDRVTDKNRVDRDYTGRQDS
SKDGKKLPDTATSIWTVGVTGMAALLAGISARLFRRKK
Molecular weight: 79.68 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|Q5WAF9|RL34_BACSK 50S ribosomal protein L34
MGKPTFQPNNRKRKKNHGFRARMATKNGRKVLARRRQKGRKVLSA
Molecular weight: 5.28 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
4,065 |
17 |
4,082 |
1,219,571 |
26 |
2,870 |
300.0 |
33.4 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.79 |
0.78 |
4.98 |
7.43 |
4.46 |
7.2 |
2.26 |
6.69 |
5.76 |
10.06 |
2.71 |
3.73 |
4.01 |
3.85 |
4.45 |
5.67 |
5.51 |
7.25 |
1.1 |
3.33 |
Note: For statistics only major isoforms were used (in this case 4,065 proteins)
For dipeptide frequency statistics click
here