Acinetobacter haemolyticus CIP 64.3
Average proteome isoelectric point is 6.55
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 3,185 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|N9GJ50|N9GJ50_ACIHA Uncharacterized protein (Fragment)
ADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADLLAEITIVADVDGDNIITGSELNGSADLEV
HIGLGADAYEGMEVELNVDGELSTHIVTADDIANGYIATTITTTGSGVINIEATATNNDGVTDTSSLVITIAPQDLITEIEVVGDVDGNGFITADELDIDGNFTVHVGLGDGAYEGLVVSVNGSDYVVTQADLDNGYIVATIAGVDSLVNITAEASDVWGDTDSANISITVDTVAPDAPVIDPVNGTDPI
TGTAEPGTTVTVTFPDGSTAEAVVDEDGNWSVPNPGLEDGDEV
Molecular weight: 41.62 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|N9FFI4|N9FFI4_ACIHA 50S ribosomal protein L34
MKRTFQPSELKRKRVHGFRARMATKAGRQVLARRRAKGRHSLTV
Molecular weight: 5.18 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,177 |
8 |
3,185 |
987,137 |
27 |
1,693 |
310.7 |
34.8 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.56 |
0.96 |
5.23 |
5.83 |
4.29 |
6.44 |
2.42 |
6.91 |
5.53 |
10.46 |
2.47 |
4.43 |
5.62 |
3.92 |
4.46 |
6.06 |
5.37 |
6.53 |
1.27 |
3.25 |
Note: For statistics only major isoforms were used (in this case 3,177 proteins)
For dipeptide frequency statistics click
here