Bosea thiooxidans
Average proteome isoelectric point is 7.09
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 4,956 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0Q3I5E5|A0A0Q3I5E5_9BRAD Calcium-binding protein
MAIINGTAGNDIIPPPDTSGDDTISGLAGNDTIDAGAGADTVHGGAGNDVILGGAGIDTLNGNAGDDTINGGDDNDVINGNAGNDILSGDAGNDTISGGAGDDLLNGGDGDDTLNGGAGTDTLNGGNGIDVLNGGAGDDTLNGGAGDDTLNGGVGNDALNGGDGNDTMTGGLGADTMNGDAGDDTLSGGG
GDDTLDGGAGVDTLSGGNGNDTVNGGDGADTLNGDNGDDTLDGGAGADTMNGGDGADTMTGGDGADTVNGDAGDDTLEGGNGADTVNGGDGADTIAGGAAGDLLNGGAGDDEIHGDAGADEIHGGDGADEVDGGNGADNLYGEAGDDVLTGGDGTDTFHFGDGADNPFGDDEVTDLDTGEEDVIVVDVVD
PATVTVTVDDSGGSVVLDFGFGTVQIDGVSGGGTFDSIEDINDALGYEAITLV
Molecular weight: 40.63 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0Q3PKL0|A0A0Q3PKL0_9BRAD 50S ribosomal protein L34
MKRTYQPSKLVRKRRHGYRARMATKGGRKVIAARRAHGRKRLSA
Molecular weight: 5.16 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
4,917 |
39 |
4,956 |
1,539,743 |
29 |
1,793 |
313.1 |
33.8 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
13.61 |
0.8 |
5.23 |
5.59 |
3.71 |
8.9 |
1.91 |
5.11 |
3.15 |
10.64 |
2.36 |
2.29 |
3.01 |
5.39 |
7.34 |
5.1 |
5.0 |
7.44 |
1.33 |
2.08 |
Note: For statistics only major isoforms were used (in this case 4,917 proteins)
For dipeptide frequency statistics click
here