Vibrio ezurae NBRC 102218
Average proteome isoelectric point is 6.25
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 3,210 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|U3B1W8|U3B1W8_9VIBR Uncharacterized protein (Fragment)
SLDSLIITDIHNQQLLIEKEDIAIDENGHYTVTGINVDDLADGTLTVTANSTDVDGNTATVTDTVVKDYTYGDDSDDDGADITPPSVSLTDNNGEEVINGEGETATISGYLGEGGKSLDSLIISDINNQQLLIAKEDIAIDENGNYTITGINVDDLADGILTVTASSTDVDGNTTSVTDTVEKDYTYGDD
SDDDGSDITPPSVSLTDNNGEEVINGEGETAVITGYLGEGGEELTSLIITDVDGKELIIPSADIQFDGNGNYTVININVDDLADGVLTVTANSTDVDGNIVTVTDTVDKDYTSDDNSGDGAWGLTPKNGLSVAEGNTSDPIAVKLLEGGTVVLAANELLTFTFSLIGFSEGLTAQDFVLHLNTSEDYSSS
SLVNSDGDIEVTVQNISGSEIVVGRGNSDEDLLSIEVQATTDNDVELDESFTLHLIDASIGAPKPSQDEVDVTIYDNTDLVTLNREFVESANEILATLGDDILQGTAEQDTFIWKSDILDSGTDLIQDFSVGEDGIVLDDILEPTQSDSIDALLNKIEVSVIGDDVTLNIEHTGGTQTIVIQDSRSQFGD
SIANNGSFDETEILNQLIVKSTEV
Molecular weight: 62.68 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|U3B582|U3B582_9VIBR 50S ribosomal protein L34
MSKRTFQPSVLKRKRTHGFRARMATKNGRKVINARRAKGRARLSK
Molecular weight: 5.25 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,121 |
89 |
3,210 |
1,031,927 |
45 |
8,098 |
330.6 |
36.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.46 |
1.01 |
5.64 |
6.13 |
4.13 |
6.79 |
2.35 |
6.53 |
5.42 |
10.2 |
2.56 |
4.33 |
4.66 |
3.8 |
4.33 |
6.85 |
5.55 |
7.03 |
1.2 |
3.03 |
Note: For statistics only major isoforms were used (in this case 3,121 proteins)
For dipeptide frequency statistics click
here