Phormidium sp. OSCR
Average proteome isoelectric point is 5.95
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 4,156 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0N8KP89|A0A0N8KP89_9CYAN Uncharacterized protein
MAFFDSFTSALKEKWLQYYQANREWLNLHMQVAAVKTPDGGRRPPSYFIIGSLNGIEPKLAQLMLPFSRLNPDPDTLIEVIGLNFDPDIALGLDPETDLPSQGSAPSVEETEDDPFGESETGDFTAAGVAASSLVSDDPQPPAIAETPEPVAEPEPEPEPEPEPEPEVATDAALAGVTAVAQDDEEDLSI
LEDDETESPEDTPEAMLLDDGDSEESEDSSEDSSEASTPESPEADDALDLLGEAEADSDPQEADEELDPFAGLSEEPVDLETPIDASSDVSDDEASDDDMDLSAFADDEAAEDSSNAVSDDMDLDVFADDDSDSDDDADADADAADSDDIDLSAFAEDESDADEMDLDAFASDDDSDGSDDMDLDAFASD
DDSASDDDVDLAALADEGDDDMDLSAFGDDDSATDDGDDGLDLGAFGGDEDSDSDDDDMDLSAFGDDDSATDDGDDGLDLGAFGDDEDSDSDDDDMDLSAFGDDDSAADDGDDGLDLGAFGDDEDSDSDDDDNDFDLAAFGGDDEDSGLGDLGEDDELDEAAFGALMEDDDDEEDPEISNLLSDLE
Molecular weight: 59.57 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0P7ZMZ1|A0A0P7ZMZ1_9CYAN Uncharacterized protein
MNSKLTGPKVLNCDRLTMRLTMRLTMRLTMRLTMRLTMRLTMNARLRVQRR
Molecular weight: 6.18 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
4,150 |
6 |
4,156 |
1,356,204 |
23 |
3,493 |
326.8 |
36.4 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.3 |
1.02 |
5.74 |
6.63 |
3.69 |
7.07 |
1.98 |
5.6 |
3.23 |
11.44 |
1.81 |
3.59 |
5.65 |
5.27 |
6.32 |
6.47 |
5.34 |
6.51 |
1.52 |
2.81 |
Note: For statistics only major isoforms were used (in this case 4,150 proteins)
For dipeptide frequency statistics click
here