Lactobacillus similis DSM 23365 = JCM 2765
Average proteome isoelectric point is 6.51
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 3,000 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0R2FBA8|A0A0R2FBA8_9LACO Uncharacterized protein
MLSEPLTAVSLLESLTITSSFDVDSLSLNLVDSEVDKPVESEVVTTSESDETRLSDINRDDDSLAETEADMKVLSEIDALVESDSDALSEIEIELTSESDSLADVEIDVDKLSDIELLSEIEVDRDKLASRDLDADWLSDTESDVETDSLSETEPLTDSLSETEPLTDSLSEIDADSLPDSLSETEPLTD
SLSETEPNTDSLSETEPLIDSLSEIEADSLTDSLSETEPLTDSLSETEPLTDSLSETESLTDSLSETEPLTDSLSETEPLTDSLSETEPLTDSLSETEPLTDSLSETEPLTDSLSETEPLTDSLSETEPLTDSLSETEPLTDSLSEIEADSLTDSLSETEPDTDSLSETEADSLTDSLSETEPDTDSLSE
TEPLTDSLSETEPDTDSLSETEPDTNSLSETEPLTDSLSETEPDTNSLSETEPDTDSLFETEFDVDVNCEFFNDVLTESLLEALPESCNDFDVESCRLVNLLSNVLLDVLNESLAEAKAEV
Molecular weight: 54.24 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0R2FFY0|A0A0R2FFY0_9LACO 50S ribosomal protein L34
MKRTYQPKKRHRSRVHGFRKRMATSNGRKVLARRRQKGRKVLSA
Molecular weight: 5.32 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,968 |
32 |
3,000 |
913,363 |
44 |
3,420 |
307.7 |
34.0 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
9.02 |
0.46 |
5.91 |
4.93 |
3.98 |
6.86 |
2.21 |
6.34 |
5.24 |
9.85 |
2.56 |
4.35 |
5.04 |
3.86 |
4.19 |
5.72 |
7.45 |
7.47 |
1.1 |
3.44 |
Note: For statistics only major isoforms were used (in this case 2,968 proteins)
For dipeptide frequency statistics click
here