Bosea sp. Root381
Average proteome isoelectric point is 6.94
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 5,096 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0Q9H5Y1|A0A0Q9H5Y1_9BRAD Calcium-binding protein
MGGAGVDTLNGNAGDDTVSGGDDDDIVSGNAGNDILAGDAGNDTVNGGAGDDTLDGGEGDDTMSGGAGIDTMTGGAGIDTMTGGAGDDTLDGGEGDDDLTGGAGNDTLNGDAGNDTLAGGIGNDTLTGGDGDDTIGGGGGDDTLDGGAGIDTLSGGDGDDELDGGAGDDALTGGDGIDTLAGGEGNDTLD
GGDGDDDLDGGAGDDALTGGDGNDILAGGDGIDTLTGDAGDDDLDGGAGDDTVGGGEGADTLAGGDGADIVTGDEGDDTMAGGAGADELDGGDGADTIEGGDGADIALGGAGDDTVSGDAGGDELRGGEGADELDGGNGSDDLYGEAGDDTLTGGGGTDTFHFGDGADTPFGDDEVTDLSEGDEDVIEVD
VLDPATTTVTVDDSGASVVLDFGFGTIQIDGVTGGGTFESIEDINDALGYEAITLV
Molecular weight: 40.62 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0Q9I3U5|A0A0Q9I3U5_9BRAD 50S ribosomal protein L34
MKRTYQPSKLVRKRRHGYRARMATKGGRKVIAARRAHGRKRLSA
Molecular weight: 5.16 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
5,064 |
32 |
5,096 |
1,599,961 |
41 |
5,166 |
315.9 |
34.0 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
13.5 |
0.78 |
5.36 |
5.55 |
3.67 |
9.06 |
1.9 |
5.09 |
3.06 |
10.44 |
2.34 |
2.35 |
3.03 |
5.35 |
7.23 |
5.3 |
5.2 |
7.44 |
1.3 |
2.04 |
Note: For statistics only major isoforms were used (in this case 5,064 proteins)
For dipeptide frequency statistics click
here