Halolamina pelagica
Average proteome isoelectric point is 5.07
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 3,464 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0N8I033|A0A0N8I033_9EURY Putative copper-exporting P-type ATPase A
MAQTTLTVDGMACGSCEETVEDAVAALDGVDAVTADNTTDTVEIEGDVDGDAAAAAIEDAGYTVA
Molecular weight: 6.4 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0P7GL39|A0A0P7GL39_9EURY Uncharacterized protein
MARRRSDCRRAHPRSDGYRRRRWRPARPPNRARTPPPRRGRHRRGLSARHLLRAGAGTARQQLRATVGGRGAARPPRPARPRRGDARGRRRPHVPRHRPLARAGRARRRDGGGRAPGASTRPARAGPRSPQALRAGLGRRGRRRHPARLPRDVGDAPTRAAAHELVPRRRRRGARAHARDRTVPHGAARR
PARVRAGDGARGGGVGALALRARRRRRARPAVRRAVRCAGAPRRRPRRRGSRAGRRATGHPTDRSGDRRGRRRALRGGSGLPPGRLGGRRGDRLPARRPGPERPPGVRRRYQRREQFDGGVLAVRPRRPRRAAVGRARRRRRCRGAALAVGAPAGRRRRGRDGVRARRPTGRRGVPGRLAARPATAGVRR
SRTAGRTRGALCGNGGDRRVRARDARRPARSPDRRAPGVPHGVLLGPLALGL
Molecular weight: 47.74 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,459 |
5 |
3,464 |
837,918 |
29 |
1,422 |
242.2 |
26.2 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
11.78 |
0.75 |
8.05 |
8.36 |
3.25 |
8.73 |
1.94 |
3.71 |
1.67 |
8.88 |
1.79 |
2.17 |
2.44 |
4.96 |
6.86 |
5.62 |
6.4 |
8.92 |
1.19 |
2.55 |
Note: For statistics only major isoforms were used (in this case 3,459 proteins)
For dipeptide frequency statistics click
here