Paenibacillus wynnii
Average proteome isoelectric point is 6.34
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 4,821 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A098MAL2|A0A098MAL2_9BACL Uncharacterized protein
MLLPDAVYASGTPFAPTAVVTGLLMVVLPPDDGLFTVLLPDAVYASGTPFAPTAVVTGLLMMVVLLPDVGLFTVLLPDAVYASGTPFAPTTVVTDLLTVVLLPDDGLFTVLLPDAVYASGTPFAPTAVVTGLLMVVLLPDDGLFTVLLPDAVYASGTPFAPTAVVTGLLMVVLLPDDGLFTVLLVGAVYA
SGTPFAPTAVVTGLLMVVLLPDDGLFTVLLPDAVYASGTPFAPTAVVTGLLMVVLLPDDGLFTVLLPDAVYASGTPFAPTAVVTGLLMVVLLPDDGLFTVLLVGAVYASGTPFAPTAVVTGLLMVVLLPDDGLFNVLIACVVYASGTPLEPTFVVVLDAAGVVTGFFVVLLACAVYASGTPLEPTFAVVL
DTTGALGVFAATGVVTGFFAVLLTCAVYASGTPFAPTFAVVLDAAGVLGVLAAAGVVTGFFAVLLTCAVYASGTPFAPTFAVVLDAAGALGVLAAAGVVTGFFVVLLACAVYASGTPLEPTFAVVLDAAGALVVLAAAAGALAVLVAAAGVTAWLFAVLLAGVVYAVGTPLEPTFGLELGVVEILAAGMD
VAVLVFLALVDM
Molecular weight: 58.04 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A098MBQ0|A0A098MBQ0_9BACL 50S ribosomal protein L34
MRPTFRPNVSKRKKVHGFRKRMSTKNGRKVLAARRLKGRKSLSA
Molecular weight: 5.14 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
4,783 |
38 |
4,821 |
1,477,933 |
26 |
2,211 |
309.0 |
34.5 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.55 |
0.78 |
5.1 |
6.81 |
4.18 |
7.37 |
2.05 |
7.12 |
5.62 |
10.27 |
2.85 |
4.15 |
3.69 |
3.88 |
4.75 |
6.6 |
5.47 |
6.98 |
1.23 |
3.56 |
Note: For statistics only major isoforms were used (in this case 4,783 proteins)
For dipeptide frequency statistics click
here