Paenibacillus larvae subsp. larvae DSM 25430
Average proteome isoelectric point is 6.84
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 3,693 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|V9W0Q3|V9W0Q3_9BACL Uncharacterized protein
MAESAFRARASIDQIFTTTGPFYVAFQTVEYDLNGEYNPATSTFVSSQGGVYTISVSLMLAADPSVEFVSLALEGPNFSGTIFIRNTDHPDLPFTVNFTAQMNFAPGDSVRVFLQPNAGMVTVVADPIYTHFEAAKTDGAIGPTGPQGPQGEQGPQGNQGPQGGGTQGPQGPSGIQGDQGPQGTTGDQGP
QGDQGPQGDQGPQGTQGDQGPQGDQGPQGATGDQGPQGDQGPQGNQGPQGDQGPQGDQGPQGDQGPQGTQGDQGPQGTQGDQGPQGDQGPQGDQGPQGDQGPQGDQGPQGATGAQGPQGDQGPQGDQGPQGDQGPQGATGAQGPQGDQGPQGDQGPQGDQGPQGATGASGPQGPQGDQGPQGDQGPQGDQ
GPQGATGVQGPQGPQGP
Molecular weight: 39.28 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|V9WD78|V9WD78_9BACL 50S ribosomal protein L34
MRPTFNPNNRKRKKNHGFRARMSTKNGRKVLSARRQKGRKVLSA
Molecular weight: 5.18 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,690 |
3 |
3,693 |
1,007,988 |
26 |
5,369 |
273.2 |
30.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.31 |
0.92 |
4.91 |
7.19 |
4.16 |
7.23 |
2.25 |
7.12 |
6.42 |
10.0 |
2.94 |
3.79 |
3.96 |
3.97 |
5.05 |
6.03 |
5.23 |
7.0 |
1.14 |
3.4 |
Note: For statistics only major isoforms were used (in this case 3,690 proteins)
For dipeptide frequency statistics click
here