Mumps virus (strain Miyahara vaccine) (MuV)
Average proteome isoelectric point is 7.4
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 8 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>sp|P21186|NCAP_MUMPM Nucleoprotein
MSSVLKAFERFTIEQELQDRGEEGSIPPETLKSAVKVFVINTPNPTTRYHMLNFCLRIICSQNARASHRVGALITLFSLPSAGMQNHIRLADRSPEAQIERCEIDGFEPGTYRLIPNARANLTANEIAAYALLADDLPPTINNGTPYVHADVEGQPCDEIEQFLDRCYSVLIQAWVMVCKCMTAYDQPAG
SADRRFAKYQQQGRLEARYMLQPEAQRLIQTAIRKSLVVRQYLTFELQLARRQGLLSNRYYAMVGDIGKYIENSGLTAFFLTLKYALGTKWSPLSLAAFTGELTKLRSLMMLYRDLGEQARYLALLEAPQIMDFAPGGYPLIFSYAMGVGTVLDVQMRNYTYARPFLNGYYFQIGVETARRQQGTVDNRV
ADDLGLTPEQRTEVTQLIDRLARGRGAGIPGGPVNPFVPPVQQQQPAAAYEDIPALEESDDDGDEDGGAGFQNGAQAPAARQGGQNDFRVQPLQDPIQAQLFMPLYPQVSNIPNHQNHQINRIGGMEHQDLLRYNENGDSQQDARGEHGNTFPNNPNQNAQSQVGDWDE
Molecular weight: 61.37 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|P22112|SH_MUMPM Small hydrophobic protein
MPAIQPPLYPTFLLLILLSLIITLYVWIISTITYKTAVRHAALHQRSFSRWSLDHSL
Molecular weight: 6.62 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
8 |
0 |
8 |
4,977 |
57 |
2,261 |
622.1 |
69.3 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.63 |
1.93 |
4.56 |
4.84 |
3.36 |
5.65 |
1.87 |
7.84 |
4.26 |
10.59 |
2.31 |
5.2 |
5.08 |
5.36 |
5.08 |
8.62 |
6.41 |
5.77 |
1.13 |
3.52 |
Note: For statistics only major isoforms were used (in this case 8 proteins)
For dipeptide frequency statistics click
here