Spodoptera frugiperda ascovirus 1a (SfAV-1a)
Average proteome isoelectric point is 7.32
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 123 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|Q0E4Z2|Q0E4Z2_SFAVA 22.4 kDa CTD phosphatase
MFSTSSNDEGGGGGGGGIAIRNASRPTIFLDLDNTLICSLRVRSAESDTAKTVNGLVPTIVFADYEVYKRPHLDEFLTYLFDNFRVAVWTAASRDYAAVITSEFILRNHPDRELELFLSGEDTRIASEELGGVKNLNALWDLWDVSSVMDRGDALIIDDLPDVFTTQPDKCIPIVAYYAQDPRAVKDDAL
QQVMDDLDSRYT
Molecular weight: 22.44 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|Q0E553|Q0E553_SFAVA 64.6 kDa
MASKRKPARLNAEQCETFKRNKQAVSPLTNCPIDKFGRTAARFRKECDIASPPTRYTSSVCKKFLANKTVSPYSGRPIKPGKKLYNDLEKHCSGRGTSPSRRSRSRSMSPRRRASPARRRASPNRSKPAKRTAANADERPDYCTNFHRDESRNPLTGKKLVPTSPIRKAWHKMCSGTVQTRSTKCIAFDK
NDKINPFTGRPINENNDTYRMIYSMCHGARYLPKKRSPRRKNKSPARTVSFSPNRRSRSPSIGARRRPARPLRPSTSRSKTRSPSKSRSPSRRRSASKSRSPSRRRSASKSRSPSRRRSASKSRSPSRRRSASKSRSPSRRRSASKSRSPSMRRSMSMARRSPSQRRSTSVARRSPSQRRSTSVARRSPS
QRRSMSVARRSPSQRRSMSVARRSPSQRRSTSVARRSPSQRRSTSVARRSPSQSRRMTTPSRSPSRQRTSSSSRRMSARRSPSYSMSPYRGRVLMTPMPEDAEPLSQDQLMRIASRMNVAQLRHVVTRNGFQPVDVAFNTNSSQLLNLVRYHIREGNIKWLPANDQNVPNYRTTARPFMDRMKKN
Molecular weight: 64.55 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
123 |
0 |
123 |
37,551 |
65 |
1,157 |
305.3 |
34.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.26 |
2.81 |
6.62 |
4.9 |
3.42 |
4.96 |
2.5 |
4.88 |
4.5 |
8.26 |
2.81 |
5.06 |
2.55 |
3.78 |
8.27 |
8.12 |
6.87 |
8.5 |
0.96 |
3.98 |
Note: For statistics only major isoforms were used (in this case 123 proteins)
For dipeptide frequency statistics click
here