Deltaproteobacteria bacterium SM23_61
Average proteome isoelectric point is 7.49
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 3,541 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0S8HYX8|A0A0S8HYX8_9DELT Flagellar hook protein FlgE
MSLGSSFYAALSGMSTNGMAMQVISDNIANANTVGFKSTSTQFEDILGMSLEGIAGFTHLGVGANVSAMPCAFTQGTLMTTTVGTDVAINGKGFFIVEDPVNNEQFYSRAGNFHVDEDGYLVNVNDLRVQGYLYDSTGTNLIEVLDDIVINQTTMVPPSITGEIDMVLNLDSAEDALVFDLNDPGATSNY
STALTIYDTLGQSHTITVYFTKTGIQAWEWNATIDGSDVSGGTPGTAELFGTGALAFDDYGVLQTAMPVNFYTGAITFANGIDATAIDVDYSSTTQYGSPSVIQILTQDGYAAGNLSGISIVTNGNIVGHFTNGEVKNLARLALAEFPSYMGLERAGSMLFKQTTDSGIPLIGKPGEAGMGEVSAGMLEE
SNVDLATEFIRMIVTQRAYQANSKVISTTDEMLAQLMTIK
Molecular weight: 44.43 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0S8HYN6|A0A0S8HYN6_9DELT 50S ribosomal protein L34
MKRTYQPSNIRRKRTHGFRKRMSTKGGRLVLKRRRAKGRKRLIVEVKES
Molecular weight: 5.95 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,502 |
39 |
3,541 |
1,009,040 |
34 |
2,600 |
288.1 |
32.0 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.52 |
1.15 |
4.48 |
6.99 |
4.44 |
8.57 |
1.87 |
6.3 |
5.88 |
10.38 |
2.68 |
2.82 |
3.2 |
5.12 |
6.49 |
5.52 |
4.52 |
7.05 |
1.21 |
2.8 |
Note: For statistics only major isoforms were used (in this case 3,502 proteins)
For dipeptide frequency statistics click
here