Mycoplasma sp. CAG:956
Average proteome isoelectric point is 6.77
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 1,369 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|R5M9C6|R5M9C6_9MOLU Uncharacterized protein
MSNENNNGVIDFDGSSFIQNNETTSNQMPASSEVANTNTNVSNGTTASDINADDIFGTWNDASSTQEEVKPVSNDYNNSNINEQAKDNTVPLNVEDVFGNTDNNQTTVSSDENKAALSIDANLNNSETTASNVSNKELESNNELTALALDAFTNMTSSDHLQENNQSVGSEVQPEIKETVGNDASNVVNP
FEVNLGSNEPTDNGNSDSSIVNQSISPVNNGDTFQSSNSGIADFNAFMVQENNVNQNLDNNVYSGDGTSQANPLNTVTNQGENSIQDVNNIPSFEQNNDFNQPSLDNQFAVKESVSTENANNQNIQTTENTANLTDNGNLSVTNETFGSDAAPVLESKTSMELNNQPTFNANINQESIPQAVNTPVEPVA
DINTVSNIENTNPVNNGIVNDNSVSANNFSSNGSIAPAMNTDISNNSSNQAINLENNVAVNSNGNVNPEITGNNNPVEINSNVSSDNTNNANYQNVLKEVNSNLLDNQNTNNGGTPLNPEPTLNAGNDVTLDNSINVGSIPNSNVNTPGVVDNNTTTGDSGKKNGKVSIPVVMLIIIVVVSAVVIVLRRN
ELMGFFQTLINK
Molecular weight: 61.83 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|R5MVX7|R5MVX7_9MOLU Uncharacterized protein
MAVKITNKKPKSMNRRSHALNKTNHFQKPNMITITVNGVKIKTSAREARTILKAN
Molecular weight: 6.23 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
1,368 |
1 |
1,369 |
422,168 |
29 |
3,265 |
308.6 |
35.3 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
4.64 |
1.15 |
6.35 |
6.61 |
4.24 |
5.14 |
1.25 |
9.59 |
9.78 |
9.51 |
2.28 |
8.09 |
2.14 |
2.39 |
2.95 |
6.32 |
5.7 |
5.74 |
0.59 |
5.54 |
Note: For statistics only major isoforms were used (in this case 1,368 proteins)
For dipeptide frequency statistics click
here