Buchnera aphidicola (Cinara tujafilina)
Average proteome isoelectric point is 8.85
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 359 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|F7WZ74|F7WZ74_9ENTR Cell division protein FtsZ
MFEPVNLENDAIIKVIGIGGGGSNAVEHMIREKIEGVEFFAINTDAQALRKIDVGQTIQIGNNITKGLGAGANPEVGRTAAEEDTERLKSALEGADMIFIAAGMGGGTGTGATPIIAKIARDLGILTVAVVTKPFSFEGKKRMIYAEQGLQELSKSVDSLITIPNDKLLKVLSRGISLLDAFKAANDILK
GAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGTGSASGENRAEEASEIAISSPLLEDIDLSGTKGVLVNITAGFDLRLDEFETVGNTIRAFSSDNATVVIGTSLDPKMEESLRVTVVATGIGGDKHSDIMLMNNRSSKDMLLGYQNKLSLNQNDTNNTYSENKMKEKNITPNNQNEKIF
Molecular weight: 39.78 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|F7WYV5|F7WYV5_9ENTR 50S ribosomal protein L34
MKRTFQPSKIKRARTHGFRTRMSTKNGRHILSRRRIKSRIRLCV
Molecular weight: 5.37 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
359 |
0 |
359 |
115,088 |
38 |
1,420 |
320.6 |
36.9 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
3.91 |
1.37 |
3.92 |
4.3 |
5.3 |
5.18 |
2.18 |
12.74 |
10.82 |
10.05 |
2.12 |
7.62 |
3.24 |
2.96 |
3.56 |
6.67 |
4.55 |
4.33 |
0.85 |
4.31 |
Note: For statistics only major isoforms were used (in this case 359 proteins)
For dipeptide frequency statistics click
here