Zinderia insecticola (strain CARI)
Average proteome isoelectric point is 9.5
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 206 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|E0TIY8|E0TIY8_ZINIC Chaperone protein DnaK
MSKIIGIDLGTTNSCVSIMEGNQSKVIENSEGSRTTPSVVAYQENGEILVGSPAKRQAITNPKNTIYAAKRLIGRKFNEKEVQKDIDIMPYEIIKSNNGDAWINIRNKKIAPPQISAEVLKKMKKTAEDYLGFKVNEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAFGLDKVLNNDKK
IAVYDLGGGTFDISIIEISNIEGEKQFEVLSTNGDTFLGGEDFDKKLIDYVINEFKKNNGIDLYKDSIALQRIKSSVERAKIELSSLYETEINEPYITVNNNIPLHLNLKITRSKFESLVEDLINKTIKPCEIAVKDAKININEISDVILVGGMTRMPKIQEKVKIFFNKEPRKDINPDEAVAIGAAIQG
AVISGDKKDLLLLDVTPLSLGIETMGGIMTKMIKKNTTIPTKFSQVFSTAEDNQPMVTIRIYQGEREMANNNKLLGEFNLEGIESAPRGVPQIEVTFDIDVNGILHVTAKDKNTNKENKITIKANSGLNENEIEKMIKDAEINSEEDKKIKDLIEVKNKADTLIHSANKIIEKNSNLISENDINNLKKEI
IELEDLVKLNDKIKIENKINSLSVILQKINSEIYKNKNINKKDEDIKNNNEDLEKNDENKVVDKDFKDIK
Molecular weight: 71.59 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|E0TIK8|E0TIK8_ZINIC 50S ribosomal subunit protein L34
MKRTYQPSKIKYIRKNGFRRRILSKSGKIIIKNKIRKKLNKKIK
Molecular weight: 5.4 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
206 |
0 |
206 |
62,563 |
37 |
1,291 |
303.7 |
36.0 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
1.65 |
1.07 |
2.27 |
3.28 |
6.92 |
3.7 |
0.96 |
17.49 |
17.95 |
9.3 |
1.23 |
12.81 |
1.18 |
1.97 |
2.04 |
5.19 |
2.61 |
2.05 |
0.6 |
5.75 |
Note: For statistics only major isoforms were used (in this case 206 proteins)
For dipeptide frequency statistics click
here