Aeromicrobium sp. Root344
Average proteome isoelectric point is 5.97
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 3,738 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0Q6VH00|A0A0Q6VH00_9ACTN Uncharacterized protein
MKIRKATMALGTLVLASGTSIGFAGSASAAPASLVTADSCVDNSADTSADTNADTDADADTDADTSANTDATDSTSVNVDADGDETDGQLVTLIEGVAISAPNAINSEAGQLTTGTETDGNLITQNTDINAISSTNSTITDGVVATSQNTDGGLALGTDDDALDIDAVASTNSIATDVGANEAGTIATGT
ETDGNLIDQNLDIDAVASTNSVALDGLLATSTTGTETDGEVAAGLDLDAVASTNSIATDVDGTTGLEAVTGTQTTGELVTSGTDADAIASTNSIGVQGITAVTSTSGTTTDGQVAAGLDLDAVTANDAVGVEGLEAVTADAGVSGTAGATTQGELVDTGLDISAVASPNSVGVAGLLATGTETDGGAVAN
LDVDAVSNTNAILGDTDLDAVAVEGALDGLLTTGLTGTSTTSVLSATQFKAASDDCDDDALPDTGGSNLGLLAAGGVLVAAGGAVIFGARRRQQA
Molecular weight: 45.66 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0Q6V7M3|A0A0Q6V7M3_9ACTN 50S ribosomal protein L34
MSKRTFQPNNRRRAKKHGFRLRMRTRAGRAILADRRRKGRAKLSA
Molecular weight: 5.38 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,703 |
35 |
3,738 |
1,163,726 |
40 |
2,996 |
314.3 |
33.8 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
12.56 |
0.65 |
6.61 |
5.6 |
3.07 |
8.91 |
2.17 |
4.39 |
2.59 |
9.98 |
1.97 |
2.02 |
2.81 |
5.18 |
6.91 |
5.68 |
6.28 |
9.04 |
1.51 |
2.09 |
Note: For statistics only major isoforms were used (in this case 3,703 proteins)
For dipeptide frequency statistics click
here