Canis familiaris papillomavirus 2
Average proteome isoelectric point is 6.12
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 8 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|Q647I0|Q647I0_9PAPI Protein E7
MRGSSPIIRDIDLELEELVLPANLLSGETLETEEEELQREPGRYRVVTLCNICHSSLRLFVEVADESLIRLFQQLLLDGLGIICATCHKEHFSDGRRR
Molecular weight: 11.21 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|Q647H8|Q647H8_9PAPI Regulatory protein E2
MLESLARRFDVLQEVMLHHYESGSKKLTDQCNYWEAARRESALLHYARKNRITRLGITPVPSLATSENSAKKAIRMSLLLSSLCNSPYKDEPWTLADTSIELWECPPKGCFKKGGFTVDVLFDNDPGNVFPYTAWAYIYYQNQNDEWIKVPGQVDYDGLFYTDEDGEKRYYQTFAKDALRFGTTGMWKVC
YKHHVLSALISSSGSSNSAASSSWQSNIESSSGDQWSAQWQWEGPTGSSASSTAASVSSSSTCSRTGGTREAGGSFDQGGSSQAGGAERGRGRGRGRGRGRGRGRASSGSGSGSGSTSRSGSRSDSVSGSGGAKPVYPQPRVGGNKAPQKRQREAPSDTEDLPRNRGVLGRGRGASPSTWSSNVRNIPPN
TPTIPTLSTPGPCPGDRAGVGRGGGPREPKAPRLSPAVPLGTVGRRPGEPQEPLEPEPGRSQEQNRPFPVILVKGDGNASKCWRRRLRLRYSGLFESISTGFSWTTASGPHRVCRPRMLIAFNSDGQRDHFLKNIKIPKVLDIALGSFDSL
Molecular weight: 57.52 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
8 |
0 |
8 |
2,754 |
41 |
607 |
344.2 |
38.1 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
5.48 |
2.69 |
5.56 |
6.17 |
4.36 |
8.32 |
1.96 |
4.1 |
4.47 |
9.01 |
1.74 |
4.03 |
3.59 |
7.73 |
6.57 |
8.53 |
5.81 |
5.85 |
1.38 |
2.65 |
Note: For statistics only major isoforms were used (in this case 8 proteins)
For dipeptide frequency statistics click
here